- Recombinant Mycoplasma pneumoniae Uncharacterized protein MG055.2 homolog (MPN_070)
- MyBioSource.com
- Pricing InfoSupplier PageView Company Product Page
- MBS1254156
- 1 mg (E Coli Derived)
- This item requires custom production and lead time is between 5-9 weeks. We can custom produce according to your specifications
- >90%
- Recombinant Protein
- 14,519 Da
- E Coli or Yeast
- 1-127
- D09_orf127a
- Uncharacterized protein MG055.2 homolog (MPN_070)
Sequence
MKVIKKLNLLNELTMLVCIFFFVCTISLIGIGIMYDLINRTSLSAPRRDPIFRNLNTVLIVLGVLEILLMVAQLVMSNMAANIINEVAENVEQKFAKALKWSRFLPFGLLQLYCYHKIKLVTQTDNI